Biotinylated Her3 His&Avi Tag Protein, Human
SKU: 2236039303

Biotinylated Her3 His&Avi Tag Protein, Human

Sale price$210.60 Regular price$234.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated Her3 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms Her3, FERLK, LCCS2, VSCN1 Accession P21860 Amino Acid Sequence Ser20 Thr643, with C terminal 10*His &Avi tag

Product Specification


Species Human
Synonyms Her3, FERLK, LCCS2, VSCN1
Accession P21860
Amino Acid Sequence

Ser20-Thr643, with C-terminal 10*His &Avi tag SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGGGSHHHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

90-95kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Zhang N. et al. (2016) HER3/ErbB3, an emerging cancer therapeutic target. Acta Biochim Biophys Sin. 48(1): 39-48.

Background

HER3 is a member of the HER (EGFR/ErbB) receptor family consisting of four closely related type 1 transmembrane receptors (EGFR, HER2, HER3, and HER4). HER receptors are part of a complex signaling network intertwined with the Ras/Raf/MAPK, PI3K/AKT, JAK/STAT, and PKC signaling pathways. Aberrant activation of the HER receptors and downstream signaling molecules tips the balance on cellular events, leading to various types of cancers. The HER3 protein is expressed in several types of tumors. That fact, together with the role of HER3 in promoting cell proliferation, implicate that targeting HER3 may have therapeutic relevance. Furthermore, expression and activation of HER3 has been linked to resistance to drugs that target other HER receptors such as agents that act on EGFR or HER2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2236039303

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 2500 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
S. Mahaffey
Pawtucket, US
★★★★★ 5
Excellently done!
Format: Kindle
Welcome to the jungle! This is the first volume of “The Jungle Book.” Mowgli is a man-cub who is raised by a wolf pack in the jungle. Other stories included in this book is Rikki-Tikki-Tavi, Toomai of the elephants and the white seal. The stories were enjoyable to read. The artwork was perfect for the stories of the book. If you are expecting the story to be like the Disney movie — it’s not. There are some scary moments in the story. It’s a fascinating look of what life in the jungle could be like. Reading this manga story has made me want to go and read the original story. I have also become a fan of manga graphic novels . This is the first time that I have read one. This manga is very well done. I recommend it to everyone! Disclaimer: I received an arc of this book from the author/publisher from Netgalley. I wasn’t obligated to write a favorable review or any review at all. The opinions expressed are strictly my own.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2022
A
Avid Reader
Lowell, US
★★★★★ 5
Superb Retelling of Classic Tales
Format: Paperback
The Jungle Book, by Rudyard Kipling and Chrystal S. Chan, is an illustrated Manga Classic book retelling seven different stories in a complete illustrated format. Six poems are interspersed among the stories, providing a sing-song character feel while helping to clarify the culture being illustrated. The stories target younger readers who enjoy action and adventure. Since this is a Manga book and is read differently than others types of books, a brief but detailed explanation is provided as well. I found the artwork to be superb, from the human characters to the animals. The detail that accompanied the characters is well drawn and easy to understand. It is obvious the artist has years of art experience, being able to create this type of book with the detail you see. Stories such as The Jungle Book are based on much longer books, and these graphic novels must present the right words (and the right amount) to move the story along to let the reader experience the story to its fullest, and this book certainly did not disappoint. This book was a quick and thoroughly enjoyable read, and hard to put down. With each new story came a set of exciting new characters, adventures and background history of its people. You see a culture that may contrast sharply with the one you’ve grown up with, and it goes far it describing the various castes in this society. I would highly recommend this book to anyone who enjoys reading Manga comics, especially for those who embrace adventure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 23, 2017
N
Nicola Mansfield
Phoenix, US
★★★★★ 4
I love this series and have read them all
Format: Paperback
I was so thrilled when I saw a new Manga Classics was out! I love this series and have read them all. Jungle Book excited me as 1) I've read the original and 2) these are short stories, something the series has not done before. The art is just as magnificent as on previous volumes and the author notes on adapting the original at the back are as illuminating as ever. This series stay as close to the originals as possible only adding artistic license where necessary to adapting a printed word novel to an illustrated manga format. The Jungle Book succeeds and presents a well-told version of the original seven stories: 4 featuring Mowgli and three others. The Mowgli stories aren't exactly chronological but they flow nicely told together and of the three stand-alone stories Rikki-Tikki-Tavi is my favourite as it is in the original. Be warned though that this (and others in the series) are sourced from the original material, not anything like its Disney counterpart. I don't think the short story format works as well in manga as it does in text so this is not my favourite of all the books (Great Expectations and Scarlet Letter probably are) but this is well done, nevertheless, and will encourage readers to pick up Kipling's classic if they have not already.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2017
T
T
Whiting, US
★★★★★ 5
Great work but missing an important character.
Format: Paperback
I bought this and another manga classic from Barnes&Noble and as I've read through the two, which are extremely good. I've noticed that in this one, it's missing one character Tabaqui the jackal , Shere Khan's lackey. It's just that I've read the the jungle book and in the beginning of Mowgli's Brothers Tabaqui informs the wolf family after praising them for their generous offer of scrap food that his master Shere Khan has entered their Territory and is on the hunt for man. But in this interpretation of the manga classic there's no Tabaqui the jackal. Weird isn't it. But aside from it . It's an amazing work of art. Hopefully in the future the people who worked very hard on this will make it more accurate to the story itself as well any and all future manga classic interpretations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 17, 2017
W
Words, Images, & Worlds
San Leandro, US
★★★★★ 5
Well done classic
Format: Paperback
A very well-done Manga book. The artist captures the feel of these books and retells the classic Rudyard Kipling story in an eye-catching way. Recommended for young readers and as a classroom or library resource.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 2, 2017

recommand products