Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated B7-H3/CD276 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms B7 H3, CD276; B7H3, B7 H3, CD276 antigen, CD276 molecule, CD276, B7H34Ig B7 H3, B7 H3B7 homolog 3, Costimulatory molecule Accession Q5ZPR3 2 Amino Acid Sequence Leu29 Pro245, with C terminal 10*His&Avi tag
Product Specification
| Species | Human |
| Synonyms | B7-H3, CD276;B7H3, B7-H3, CD276 antigen, CD276 molecule, CD276, B7H34Ig-B7-H3, B7-H3B7 homolog 3, Costimulatory molecule |
| Accession | Q5ZPR3-2 |
| Amino Acid Sequence | Leu29-Pro245, with C-terminal 10*His&Avi tag LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPHHHHHHHHHHGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 38-48kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Liu J. et al. (2021) Targeting B7-H3 via chimeric antigen receptor T cells and bispecific killer cell engagers augments antitumor response of cytotoxic lymphocytes. J Hematol Oncol. 14(1): 21. |
Background
B7-h3 (B7 homolog 3 protein), also known as CD276, is an important immune checkpoint molecule in the B7-CD28 family. It is a type I transmembrane glycoprotein consisting of 316 amino acids and contains a putative 28AA signal peptide, a 217AA extracellular region composed of immunoglobulin constant (IgC) and variable (IgV) structures, a transmembrane region, and a 45-amino acid cytoplasmic domain. B7-H3 is a T cell co-suppressor molecule with partial co-stimulatory function. B7-H3 can effectively inhibit the function of T cells and NK cells, and also play a role in bone development. The expression of B7-H3 is low in normal tissues and is found in a variety of malignant tumors, which is closely related to the growth, metastasis, recurrence and poor prognosis of malignant tumors. B7-H3 can down-regulate T-assisted type 1 mediated immune response, inhibit CD4+T cell activation and inhibit cytokine production, and thus may play a role in promoting immune escape of cancer cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy