Mouse IgG lambda1, His tag
SKU: 67351463476

Mouse IgG lambda1, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IgG lambda1, His tagProduct Specification Species Mouse Accession P01843 Amino Acid Sequence Protein sequence (P01843, Gln1 Ser105, with C 10*His) QPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRADCSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 3 kDa Observed MW: 15 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Mouse
Accession P01843
Amino Acid Sequence

Protein sequence (P01843, Gln1-Ser105, with C-10*His) QPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRADCSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.3 kDa Observed MW: 15 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. Representing approximately 75% of serum antibodies in humans, IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Lambda light chains are one of the two classes of light chains present on mammalian immunoglobulins. They are found in combination with kappa light chains. These chains are usually present in a 70:30 ratio of kappa to lambda. Anti-lambda light chain antibodies can nonspecifically bind to multiple isotypes of immunoglobulins.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 67351463476

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1792 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Shire23
Phoenix, US
★★★★★ 5
Great Replacement Cabin Air Filters for my 2008 Honda Civic
Size: 2Pcs, Size: 2Pcs
Item Reviewed: CF10134 Cabin Air Filter with Activated Carbon Replacement for CP134, Fit for Honda Accord/Civic/Odyssey/CR-V and Acura MDX/TSX/TLX/RDX/Ridgeline (2 pack) ℹ️ Summary I picked these up because I needed some replacement cabin air filters for my 2008 Honda Civic. These seem like decent quality and they were a perfect fit in my car. For $15 at time of order for two air filters it was a solid deal that I can glad recommend to others. I hate writing short reviews, but there’s not much else to say about these. Here is how I rate items: 5 ⭐️ = Completely exceeds expectations. 4 ⭐️ = Works well with minor concerns. 3 ⭐️ = Does the job, nothing special. 2 ⭐️ = Some things work, but lots of issues. 1 ⭐️ = Didn’t work well, not worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2025
T
TLau
Houston, US
★★★★★ 4
Good fit for Acura MDX
Size: 8.8" x 9.3" x 1.1"
This is an air cabin filter that will fit many cars, and in my case a 2019 MDX. Since this kind of filter is not doing anything critical like keeping dirt out of an engine, I shop around for non-OEM filters for something that strikes a balance between price versus performance. This filter just filters out dust in a car cabin, and when we’re not in our cars, we don’t have the benefit of an air filter when we are walking around outdoors. At a fraction of the price of an Acura filter, this filter seems to strike that balance. The filter media looks sturdy and is embedded with charcoal to help absorb odors. Installation is very straightforward in my MDX, and similar in most cars. There is a compartment door inside the glovebox that first must be removed before changing the filter. Pay attention to the direction flow arrow that shows which way the filter should be installed. Overall I am satisfied with this filter. It is inexpensive, fits perfectly, and seems to do the job just fine. It is definitely worth trying if you are trying to save money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 12, 2024
S
Shop by Interest
Charlottesville, US
★★★★★ 5
These filters do the job
Size: 2Pcs
Fits great in my '08 Accord LX and my '19 Accord Sport 2.0t. They filter air well and are easy to install like any cabin air filter in a Honda. I am pleased. Good value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 8, 2025
L
Lars A. Morgan
Massapequa, US
★★★★★ 5
Fit my 2014 Odyssey TE
Size: 8.8" x 9.3" x 1.1"
Comes with printed instructions for those who haven't changed it before. Here is the specific use case from my van. On my 2014 TE its easy to access behind the glove box, open to usual full open then just push the left and right sides in to allow the glove box to come fully out. It may pop off of the mounts, don't panic it snaps right back on. Then look for the little rectangular panel with two small levers on either side. on the black plastic under the dash that you can now see and access. Press the levers and pull towards you, doing a bit of a wiggle to get it out. Its tight, but it will come out with having to break it. Don't gorilla hands it, it will break. There is a directional arrow on the filter, which you have to remove from the wrapper before installing. Yes, someone *will* forget that. Reassembly the reverse of removal. Check that video sharing site online if you need visual instructions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2024
D
Verified Purchase
David
Omaha, US
★★★★★ 5
Fits perfectly, and works great!!
Item Package Quantity: 1
★★★★★ – Great Quality Cabin Filter for the Price Installed this Puroma cabin air filter in my car and immediately noticed cleaner airflow and less odor coming through the vents. The activated carbon really helps with smells and dust. Installation was quick and easy, only took a few minutes. Great value compared to dealership prices. Would definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products