Rat Ig gamma-1 chain C region, His tag
SKU: 86338277998

Rat Ig gamma-1 chain C region, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Ig gamma-1 chain C region, His tagProduct Specification Species Rat Accession P20759 Amino Acid Sequence Protein sequence (P20759, Ala1 Lys326, with C 10*His)

Product Specification


Species Rat
Accession P20759
Amino Acid Sequence

Protein sequence (P20759, Ala1-Lys326, with C-10*His) AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRPPEEQFNSTFRSVSELPILHQDWLNGRTFRCKVTSAAFPSPIEKTISKPEGRTQVPHVYTMSPTKEEMTQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 37.6 kDa Observed MW: 45-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Ig gamma-1 chain C region (IGHG1) is considered an emerging prognostic marker. The upregulation of IGHG1 is strongly associated with various malignancies, including colorectal cancer, gastric cancer, prostate cancer, papillary thyroid carcinoma, leukemia, ovarian cancer, and breast cancer. In colorectal cancer, the upregulation of IGHG1 contributes to increased cellular proliferation. MEK-FECH signaling is upregulated in IGHG1-overexpressing colorectal carcinomas. IGHG1 overexpression has also been reported for the induction of epithelial to mesenchymal cell transmission (EMT) in gastric cancer via tumor growth factor beta (TGF-β)/SMAD3 signaling. In prostate cancer, the inhibition of IGHG1 is linked to the suppression of MEK/ERK/c-Myc signaling, leading to reduced malignant growth. The increased expression of IGHG1 in breast cancer cells activates AKT and vascular endothelial growth factor (VEGF) signaling, leading to enhanced cell proliferation, invasion, and angiogenesis. IGHG1-silencing can suppress the neoplastic characteristics of breast cancer cells in vitro and suppresses tumor growth in nude mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86338277998

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 1600 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
NC Nurse Tom
Belleville, US
★★★★★ 4
Single-ingredient moisturizing treatment with a pleasant smell
When this is described as "batana oil," that's exactly what it is. Not a dozen other ingredients with just a little bit of batana, no colors or fragrances, just batana oil. I love that about this. It's easy to use, just melt it into you hands and massage it into your scalp and hair. Folks with long hair would do well to concentrate on the ends since that's where you're less likely to get natural oil from your scalp to help keep the hair healthy. Leave it in for a bit, then wash it off in the shower with shampoo. Not at all complicated. I loved how my scalp felt afterward, definitely less itchy and "tight." as far as regrowing any hair or anything, I think the only thing that would help me is a miracle, so I'm not basing my review on that. The smell is nutty and very nice. Similar to the roasty notes of coffee or chocolate. Very pleasant and not "chemical" or perfumey smelling.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
V
Verified Purchase
Vonnie
Bozeman, US
★★★★★ 1
False
Size: 4.2 Fl Oz (Pack of 1)
How does the reviews when I purchased go from 4.7 to 4.5 meaning it’s not a good product, therefore wasted money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
L
Lpenguin
Lake Worth, US
★★★★★ 5
Nice Scent but Too Early to See Results
I’ve just started using this batana oil, so it’s too early to say if it actually helps with hair growth or thickness. I’ll need to use it consistently for a while before seeing real results. So far, I do like the smell—it has a nice scent and doesn’t feel overwhelming. The oil itself feels nourishing and easy to apply to the scalp and hair. The size is decent for the price, but like most hair treatments, the effectiveness will really depend on long-term use. Pros: Pleasant scent Feels nourishing on hair and scalp Easy to apply Cons: Too early to tell results Overall, it seems promising, but you’ll need to give it time to see if it actually delivers on the hair growth claims.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
H
Hope H
Louisville, US
★★★★★ 5
Great batana oil for hair
Banana oil is so incredible, I will never stop singing its praises. I am prone to dry scalp and have thin, curly hair that needs just the right amount of moisture or it will frizz out. Batana oil has helped restore balance to my scalp and reduced flakes and it adds just enough moisture to my hair. This oil is a great version. It is thick, but not so thick that it doesn't melt in your hands if you rubs them together. I also have not noticed any stickiness or excessive left on my hands that can happen with some Banana oil brands. I do want to note that I usually put the batana oil on my scalp, let it sit for 15-20 minutes then wash it out, if you are going to let it stay in your hair, this may be too heavy for you. Otherwise, a great deal at the list price of $14, since a little goes a long way.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
E
Verified Purchase
EmeraldSunset
New York, US
★★★★★ 1
not good
Size: 4.2 Fl Oz (Pack of 1)
this burn my skin, this is not Dr. Sebi because is no longer with us.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026

recommand products