Human Plectin, His tag
SKU: 49088965308

Human Plectin, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Plectin, His tagProduct Specification Species Human Synonyms Hemidesmosomal protein 1 (HD1), Plectin 1, PLEC1 Accession Q15149 Amino Acid Sequence Protein sequence (Q15149, Leu86 Val180, with C 10*His) LHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 12. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Hemidesmosomal protein 1 (HD1), Plectin-1, PLEC1
Accession Q15149
Amino Acid Sequence

Protein sequence (Q15149, Leu86-Val180, with C-10*His) LHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Plectin is a giant protein found in nearly all mammalian cells which acts as a link between the three main components of the cytoskeleton: actin microfilaments, microtubules and intermediate filaments. In addition, plectin links the cytoskeleton to junctions found in the plasma membrane that structurally connect different cells. By holding these different networks together, plectin plays an important role in maintaining the mechanical integrity and viscoelastic properties of tissues. Mutations in PLEC have been associated with epidermolysis bullosa simplex with muscular dystrophy. A missense variant of PLEC has been recently proposed as a cause of atrial fibrillation in some populations. Isolated left ventricular non-compaction accompanying epidermolysis bullosa simplex with muscular dystrophy was also noted. Plectin has been proposed as a biomarker for pancreatic cancer. Although normally a cytoplasmic protein, plectin is expressed on the cell membrane in pancreatic ductal adenocarcinoma (PDAC) and can therefore be used to target PDAC cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49088965308

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 2318 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
S. Edmund
Grantham, US
★★★★★ 5
The Best Sunglasses
Color: Black
I was hesitant to purchase these at first. I'm so glad I did, though. They are light-weight, comfortable, and super stylish. I work in the desert, so the side guards are very helpful in keeping the sand and dust out (not entirely, but they help). I will absolutely purchase again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2024
J
Verified Purchase
JAMES C
Dallas, US
★★★★★ 5
Best battery bank I have used so far
Color: Black, Color: Black
Omg I love this thing. Ordered one from Anker and it took a few days to get to me. Loved it so much I ordered two more from Amazon due to shipping speed. I also own the larger version of this with the retractable cable and kept it as my primary battery Bank. The device is small enough to easily fit and comfortably hold in my pocket. It's super fast charges my phone with its retractable cable which is insanely useful. The digital display on it is perfectly designed. I currently use three devices consistently throughout my entire day that require recharging. This battery bank is insanely useful. The difference between this bank and the others comes down to a few things. Really good brand name as Anker has made some really good products over the years. The retractable usb-c cable is absolutely a game changer. The 10,000 mah battery can charge my phone twice before needing to recharged. It's a small cube and for me I can easily just throw it in my pocket or if somebody was to add a metal clip they could just clip it to their clothes and forget about it. I travel a lot so you have no idea how awesome it is to have a device die and simply just plug it in to the bank and continue walking without having to find a power outlet. If I could suggest anything he would be for the brand to conclude a clip that we can use so I could clip it to my backpack. Well that's it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
M
Verified Purchase
MrFoo
Phoenix, US
★★★★★ 5
Great overall charger, retractable USB-C huge benefit.
Color: Green
This charger works great. Charges my S22 fast, able to charge multiple devices at once and can even recharge while charging a device at the same time. I like the screen and info it shows including the % charge remaining, input and output wastage, and battery cycles. The retractable USB-C is a huge benefit so you don't have to carry a separate cord around. Also being able to recharge with the same built in USB-C huge benefit. Have not dropped it but would be a bit worried I would damage the screen if I did but overall has very compact and durable feel to it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
M
Verified Purchase
Mrs Zena
Birmingham, US
★★★★★ 5
Compact, charges fast, 2x recharge capacity.
Color: White
Great product. Size of 2 ice cubes and a little weighty. Charges and recharges fast. Included cable made traveling easy and less things to lose and get tangled in your backpack/case.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
D
Verified Purchase
DKen
Draper, US
★★★★★ 5
Powerful, superfast, excellent value
Color: Black
Product is exactly as expected, compact, charges super fast, love the retractable cable, easy to use the display and love the features. Powered on/off with ease. As for reliability, I've only had it a couple of days so we'll see. Would definitely recommend this to others.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026

recommand products