Biotinylated TNFSF11/RANKL Avi&Fc Protein, Human
SKU: 90108228903

Biotinylated TNFSF11/RANKL Avi&Fc Protein, Human

Sale price$688.50 Regular price$765.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 6 - Jul 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated TNFSF11/RANKL Avi&Fc Protein, HumanProduct Specification Species Human Synonyms RANKL, CD254, TRANCE, OPGL, ODF Accession AAC51762. 1 Amino Acid Sequence Gly 64 Asp245, with N terminal Avi Tag & Human IgG1 Fc

Product Specification


Species Human
Synonyms RANKL, CD254, TRANCE, OPGL, ODF
Accession AAC51762.1
Amino Acid Sequence

Gly 64-Asp245, with N-terminal Avi Tag & Human IgG1 Fc GLNDIFEAQKIEWHEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGSGGGSGGGSGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Paul R. Odgren, Nacksung Kim, Carole A. MacKay, April Mason-Savas, Yongwon Choi &Sandy C. Marks, Jr.: The Role of RANKL (TRANCE/TNFSF11), a Tumor Necrosis Factor Family Member, in Skeletal Development: Connective Tissue Research, Volume 44, 2003, Pages 264-271.

Background

RANKL (also known as TRANCE or OPGL) is a member of the TNF ligand superfamily. RANKL is produced by T cells, mammary epithelial cells and endothelial cells. RANKL, through its ability to stimulate osteoclast formation and activity, is a critical mediator of bone resorption and overall bone density. RANK and RANKL are key regulators of bone remodeling and regulate T cell/dendritic cell communications, and lymph node formation.RANK-RANKL signaling not only activates a variety of downstream signaling pathways required for osteoclast development, but crosstalk with other signaling pathways also fine-tunes bone homeostasis both in normal physiology and disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90108228903

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 178 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Vicky Wu
Charlottesville, US
★★★★★ 4
Helpful but could be a little shorter
Format: Kindle
Disclaimer: I’ve read the Study Guide version and completed the Biblical Counseling training by City-to-City which went through the model prior to reading this book. Personally I think this could be a very helpful introduction to people who are new to the model of biblical change. The book is full of explanations and examples which make the model practical. However, I found the book a little too repetitive, and I felt like it could be a lot shorter than it is now. Any how, this book provides a very practical model that could benefit your ministry and help you in your personal growth. If you’re looking for something to go through with your small group, I actually recommend going straight forward to the Study Guide which sufficiently provides all the descriptions and examples needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 25, 2020
E
Verified Purchase
Elizabeth E
Whiting, US
★★★★★ 5
Real Practical Biblical Christianity Explained.
Format: Paperback
This is truly an awesome book and a must have for every believe in Jesus Christ. No Christian home should be without this book. Tripp and Lane have done an excellent job in writing this book. This is NOT another self help book. This book begins with Christ and focuses on Christ all the way. In this book, Tripp and Lane answer the question that serious Christians have been asking for some time, "why is the life style of professing Christians not different from that of their unsaved neighbors?" The answer according to Tripp and Lane is because most professing Christians have a huge gap in their understanding of the gospel. In their words "Often there is a vast gap in our grasp of the gospel. It subverts our identity as Christians and our understanding of the present work of God. This gap undermines every relationship in our lives, every decision we make and every attempt to minister to others." They go on to say that because the gospel gap in our lives must be filled, "If we do not live with a gospel-shaped, Christ-confident and change-committed Christianity, that hole will get filled with other things. These things may seem plausible and even biblical, but they will be missing the identity-provision process core that is meant to fill every believer." Some of the things on the list will surprise you. Using lots of case studies (real life examples with names changed), Tripp and Lane go on to show us how real change can happen in our lives and what it will look like as it is happening. This book is on its way to becoming a true Christian classic. Reading level: ages 18 and up
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2012
A
Verified Purchase
Amadeuz
Houston, US
★★★★★ 5
The most practical Christian book I've ever read!
Format: Paperback
I found this book on a whim from a comment a review on Amazon. And I'm so thankful that God lead me to it. Are you tired of reading Christian authors who just recite a bunch of trite, spiritual platitudes? I was. So many Christian authors nowadays lay out elaborate, idealistic metaphors about how we should be living our lives. They use flowery rhetoric to inspire. But they don't tell you practically or biblically how you can change your life to reflect these ideals. Until I read this book, I hadn't found an author who could provide direct application of the Scriptures to my circumstances. This book does that and more. My main takeways from the book are 1) How a person reacts to his/her circumstances is a direct reflection of his/her heart and 2) Change in how you react to the circumstances or "thorns" in your life ultimately depends on heart transformation by Christ. All too often, our natural inclination or reaction is to blame others for what we are going through, be it our spouse, God, a co-worker, etc. How often do we turn the microscope inward? Rarely. The reality is life is hard. You will have trials. How YOU choose to respond to the trials is the key. So often, preachers and books call for specific modifications in behavior such as memorizing Scripture, avoiding temptations, etc. Of course these modifications are not bad in and of themselves, but they do not provide lasting change. If you do not believe that the Bible is the ultimate Word of God, then this book is not for you. The entire book is bathed in Scripture. Not just snippets, but big chunks with full application and analysis. Another unique aspect of the book, is that the author fills the book with numerous real life examples that you can relate to. In other Christian books I've read, the author may give you one or two isolated examples, which are so unique that nobody can relate to them. Perhaps you won't relate to all of the examples in this book, but I guarantee that at least two or three of them will hit home. I wholeheartedly recommend this book to all people who are wondering how they can change themselves for the better using Scripture as the basis for their change.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2010
D
Verified Purchase
Debbie Neal Crawford
Grantham, US
★★★★★ 5
It's about the Heart
Do you know an anger-filled, joyless Christian who blames every wrong thing in their life on someone else? Do you struggle with marital issues that seem to never get better? How People Change by Timothy S. Lane and Paul David Tripp points the reader to the Gospel in producing lasting change…a change that comes through the heart. While I may point fingers and pray for God to change this situation or that person, the person God is intending to change is me: “God says that what needs change the most is us! He does not just work to fix situations and relationships; he is intent on rescuing us from ourselves. We are the focus of his loving, lifelong work of change.” Have you ever felt God with a scalpel begin to pierce the condition of your heart? I know I have and it is not pleasant at the time but the result is more Christ-likeness. The authors write: “But the Bible teaches again and again that our circumstances don’t cause us to act as we do. They only expose the true condition of our hearts, revealed in our words and actions.” “Our background, relationships, situation and physical condition only provide the opportunity for our thoughts, words, and actions to reveal whatever is already in our hearts. Our hearts are always the ultimate cause of our responses, and where the true spiritual battle is fought.” The authors walk the reader through four concepts to producing lasting heart change: Heat (the trial of an external situation), thorns or fruit (the response of the heart to the trial) and the cross (the new life we have in Christ). “A new lifestyle-the outward fruit of a believer’s life-does not grow out of a stoic obedience to God’s commands, but from a heart that has been captured and captivated by the Giver of those commands.” This was the first book I finished on my 2014 Reading List. It is a must read for those who are tired of their sinful responses and want to understand how to have true heart change.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2014
Z
Verified Purchase
Zachary Cochran
Port Orchard, US
★★★★★ 5
Gives an actual answer—without feeling cliché. Terrific book.
How People Change is a powerful book. It spells out in simple (not simplistic) terms how people change. It looks at Scripture and quotes from it heavily to make its points. At the center of the process of change is Jesus and the gospel. When we accept what Jesus has done for us and look at him, and continue to look at him throughout our lives instead of just at the moment of our conversion, something monumental shifts. But the shift is so subtle, but so real. I feel like I understand what life with Christ is supposed to look like now. A lot of books promise to give you the secrets to this or that. This book does give you the answer to how people change: it involves repentance no matter life's circumstances PLUS faith in who God is and living out of our new identity as his children. This is one of those books I plan to buy and give to my friends. I want more people to read this to understand what I now understand. This is truly a five star book. It's not a quick read, but wow is it worth it. If you don't read any other book this year, seriously, consider this one. In fact, go ahead, check out the sample of the book right now—if you don't end up buying and reading it, you will be missing out on grace from God in a big way.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2015

recommand products