Biotinylated CD47 His&Avi Tag Protein, Mouse
SKU: 43806211468

Biotinylated CD47 His&Avi Tag Protein, Mouse

Sale price$525.60 Regular price$584.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 6 - Jul 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD47 His&Avi Tag Protein, MouseProduct Specification Species Mouse Synonyms MER6, IAP, OA3 Accession Q61735 1 Amino Acid Sequence Gln19 Lys140, with C terminal 8*His&Avi tag QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE Expression System HEK293 Molecular Weight 33 43kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His Tag Physical Appearance

Product Specification


Species Mouse
Synonyms MER6, IAP, OA3
Accession Q61735-1
Amino Acid Sequence

Gln19-Lys140, with C-terminal 8*His&Avi tag QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight 33-43kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1. Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135. 2. Oldenborg P A. (2004) Role of CD47 in erythroid cells and in autoimmunity. Leuk Lymphoma. 45(7): 1319-1327. 3. Kaczorowski D J. et al. (2007) Targeting CD47: NO limit on therapeutic potential. Circ Res. 100(5): 602-603.

Background

CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with SIRP-α and SIRP-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43806211468

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 2299 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
deana
San Leandro, US
★★★★★ 5
Beautiful gold finish
Color: Gold-aa
Perfect gold finish for our new condo kitchen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026
T
Verified Purchase
TheInternets
Cuba, US
★★★★★ 4
Nice gold paper towel holder on a budget
Color: Gold-aa
For a less expensive option I was please with the assembly and the look. It did come a little scratched but mostly in hidden spots and for the price, can’t be beat. It is not super heavy feeling though, so if you want a really solid heavy holder this might disappoint, however I like that feature since I don’t want heavy things scratching and breaking my counter or tile floor. It doesn’t wobble and I like the color so I am mostly pleased, only giving it a little less of a review because it did come a little scratched
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
K
Verified Purchase
Kindle Customer
Grantham, US
★★★★★ 5
Does the job.
Works as a paper towel holder. Its a stick. It doesnt look like a cheap stick and it didn't break. Which means it met all my criteria. Great job.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
L
Verified Purchase
Lisa S.
Los Angeles, US
★★★★★ 5
Nice product
Color: Gold-aa
when having guests over, it's nice for each one to use their own towel instead of having a 'community' guest towel, or those fancy ones that people feel guilty using. This solved the problem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
A
Verified Purchase
Anonymous B
Charlottesville, US
★★★★★ 5
Rich
Format: Paperback
A wonderful book that illuminates the reality of the God of Israel compared to the ANE deities.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products